Protein Purification
Baculovirus Expression
E. coli Expression
Molecular Biology
Products
|
Products: Kinases: PAK1KD
PAK1KD (recombinant human PAK1 kinase domain)
| Catalog #: | Size: | Concentration: | Price: |
|
| K0104S | 10 µg | 1 mg/ml | $330 |
|
| K0104M | 100 µg | 1 mg/ml | $2,500 |
|
| K0104L | 1 mg | 1 mg/ml | $8,000 |
|
| K0104B | Bulk | 1 mg/ml | Inquiry |
Sequence:
GPHPSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMREN
KNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGM
DGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIA
TNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
- The first 4 residues GPHP are from Turbo3C cleavage site.
- Phosphorylated at T423.
Component and Formulation:
PAK1KD: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Activity:
 |
Specific activity:
32,638 pmoles/min/µg
Analysis of enzymatic activity was performed according to Zlyte assay protocol (Invitrogen):
- Different concentration of PAK1KD were incubated in a buffer containing 50 mM HEPES (pH7.5), 10 mM MgCl2, 1 mM EGTA, 200 mM ATP, 0.01% Brij-35, and 2 µM substrate (SER/THR 14, Invitrogen) at room temperature for 1 hour.
- Developer solution was added to reaction and reaction was stopped after 1h of incubation at RT.
- Fluorescence was detected using lexc=460±40 nm and lem=528±20 nm filters.
|
SDS-PAGE Analysis:
|
|